• CJC-1295 5mg
  • CJC-1295 5mg

CJC-1295 5mg

No.5mg

CJC-1295 is a peptide that activates the pituitary gland receptor for Growth Hormone Releasing

Product name
CJC-1295
Related category
Polypeptides - customer peptides; peptides
Storage condition
2-8°C Refrigerator
Specification
2mg*10vials per kit/ 5mg*10vials per kit/ 10mg *10vials per kit/ 1g powder/
Packing
neutral packing with no label logo
$4.00
  • CJC-1295 5mg

Description

CJC-1295: Unlocking the Potential of Growth Hormone Releasing Peptide at an Unbeatable Price

Overview

Product Name: CJC-1295 (CAS 863288-34-0)
Availability: 2mg/vial


Introduction

CJC-15 is a peptide that activates the pituitary gland receptor for Growth Hormone Releasing (GHRH), offering a synthetically developed alternative to the naturally occurring GHRH hormone. This innovative peptide is designed to enhance growth hormone production, promoting overall physiological benefits. With its high purity and competitive pricing, CJC-1295 stands as a remarkable option for research and therapeutic applications.


Detailed Product Information

Product Specifications

  • Product Name: CJC-12
  • Related Category: Polypeptides - Customer Peptides; Peptides
  • Storage Condition: 2-8°C Refrigerator
  • Specification:
  • 2mg*10vials per kit
  • 5mg*10vials per kit
  • 10mg*10vials per kit
  • 1g powder
  • Packing: Neutral packing with no label logo

Synonyms and Chemical Structure

  • Synonyms: CJC1295; Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-… (full chemical name provided in detailed description)
  • CAS Number: 863288-34-0

Detailed Description

CJC-1295, also known as Mod GRF 19 or tetra-substituted GRF (1-29), is a peptide that mimics the naturally occurring GHRH hormone. It comprises the initial 29 amino acids of GHRH but with four substituted amino acids at positions 2, 8, 15, and 27. These substitutions enhance the peptide's resistance to breakdown by the enzyme dipeptidyl peptidase-4.

Research indicates that CJC-1295 binds to and interacts with the GHRH receptor in the anterior pitui gland, potentially maintaining pulsatile production of growth hormone (GH). This action not only improves overall physiological levels of GH but also suggests proliferation of somatotroph cells, as confirmed by immunohistochemistry images.

Moreover, CJC-1295 and related peptides like GHRP-6 have been associated with nervous tissue protection and repair. Studies have explored the impact of GHRP-6 on the brain’s IGF-1 system, revealing increased IGF-I mRNA levels in specific brain areas such as the hypothalamus, and hippocampus. This suggests that GH and GHRP-6 may enhance the expression of IGF-I in these regions, potentially activating phosphatidylinositol kinase intracellular pathways involved in cell survival.

Purity and Formula

  • Purity: 99%
  • Formula: (Chemical formula specifics provided in detailed description)
  • Solubility: Ethanol (slightly, heated, sonicated), Methanol (slightly), Water (slightly)
  • Appearance: White powder

Storage and Handling

For optimal stability, store CJC-1295 at 2-8°C in a refrigerator. For long-term storage, it can be kept at -20°C under an inert atmosphere.


Our Advantages

Faster Delivery

We offer sample orders in stock with a quick turnaround of 3-7 days for bulk production. Our strong cooperation with DHL, TNT, UPS, FEDEX, and EMS ensures prompt and reliable delivery. Alternatively, you can choose your own shipping forwarder.

After-Sale Service

  • International Authorized Third-Party Testing: We provide third-party testing for the products you demand.
  • 60-Day Warranty: Quality assurance for 60 days after purchase.

Packing & Shipping

  • Customizable Packing: As per your requirements.
  • Prompt Shipment: After receipt of your order confirmation.
  • **Transit OptionsHL, UPS, TNT, EMS, Fedex, and more.
  • Small Orders: 3-7 days by UPS, DHL, EMS.
  • Mass Orders: 5-8 days by air, 15-30 days by sea.